SCOPe 2.03: Domain d1iiba_: 1iib A:

Lineage for d1iiba_ (1iib A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.2: PTS system IIB component-like [52794] (2 families)

5. Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (2 proteins)
   Pfam PF02302

6. Protein Enzyme IIB-cellobiose [52796] (1 species)
   of the phosphoenol-pyruvate dependent phosphotransferase system

7. Species Escherichia coli [TaxId:562] [52797] (3 PDB entries)

8. Domain d1iiba_: 1iib A: [32648]

Details for d1iiba_

PDB Entry: 1iib, 1.8 Å

PDB Description: crystal structure of iibcellobiose from escherichia coli

PDB Compounds: (A:) enzyme iib of the cellobiose-specific phosphotransferase system

SCOPe Domain Sequences for d1iiba_:

Sequence; same for both SEQRES and ATOM records:

>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]}
kkhiylfssagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqiay
mlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaa

Timeline for d1iiba_:

• d1iiba_ first appeared (with stable ids) in SCOP 1.55
  
• d1iiba_ appears in SCOPe 2.02
  
• d1iiba_ appears in SCOPe 2.04
  
• d1iiba_ appears in the current release, SCOPe 2.08