SCOP 1.59: Domain d1d1pa_: 1d1p A:

Lineage for d1d1pa_ (1d1p A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Tyrosine phosphatase [52790] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)

8. Domain d1d1pa_: 1d1p A: [32646]

Details for d1d1pa_

PDB Entry: 1d1p, 2.2 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1)

SCOP Domain Sequences for d1d1pa_:

Sequence; same for both SEQRES and ATOM records:

>d1d1pa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
pkisvaficlgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
tvqtiiedpwygdiqdfeynfkqityfskqflkkel

Timeline for d1d1pa_:

• d1d1pa_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1pa_ appears in SCOP 1.57
  
• d1d1pa_ appears in SCOP 1.61
  
• d1d1pa_ appears in the current release, SCOPe 2.08