Lineage for d1d1pa_ (1d1p A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70654Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
  4. 70655Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
  5. 70656Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein)
  6. 70657Protein Tyrosine phosphatase [52790] (3 species)
  7. 70658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)
  8. 70663Domain d1d1pa_: 1d1p A: [32646]

Details for d1d1pa_

PDB Entry: 1d1p (more details), 2.2 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1)

SCOP Domain Sequences for d1d1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1pa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
pkisvaficlgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
tvqtiiedpwygdiqdfeynfkqityfskqflkkel

SCOP Domain Coordinates for d1d1pa_:

Click to download the PDB-style file with coordinates for d1d1pa_.
(The format of our PDB-style files is described here.)

Timeline for d1d1pa_: