SCOP 1.75: Domain d1d2ab_: 1d2a B:

Lineage for d1d2ab_ (1d2a B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Tyrosine phosphatase [52790] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)

8. Domain d1d2ab_: 1d2a B: [32645]
   complexed with ade, cl, po4; mutant

Details for d1d2ab_

PDB Entry: 1d2a, 1.9 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the activator adenine

PDB Compounds: (B:) tyrosine phosphatase

SCOP Domain Sequences for d1d2ab_:

Sequence; same for both SEQRES and ATOM records:

>d1d2ab_ c.44.1.1 (B:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
tvqtiiedpwygdiqdfeynfkqityfskqflkkel

Timeline for d1d2ab_:

• d1d2ab_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2ab_ appears in SCOP 1.73
  
• d1d2ab_ appears in SCOPe 2.01
  
• d1d2ab_ appears in the current release, SCOPe 2.08