Lineage for d1d2ab_ (1d2a B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70654Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
  4. 70655Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
  5. 70656Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein)
  6. 70657Protein Tyrosine phosphatase [52790] (3 species)
  7. 70658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)
  8. 70662Domain d1d2ab_: 1d2a B: [32645]

Details for d1d2ab_

PDB Entry: 1d2a (more details), 1.9 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the activator adenine

SCOP Domain Sequences for d1d2ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ab_ c.44.1.1 (B:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
tvqtiiedpwygdiqdfeynfkqityfskqflkkel

SCOP Domain Coordinates for d1d2ab_:

Click to download the PDB-style file with coordinates for d1d2ab_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ab_: