Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
Protein automated matches [190734] (14 species) not a true protein |
Species Sulfolobus islandicus [TaxId:930945] [326429] (1 PDB entry) |
Domain d5ewta_: 5ewt A: [326430] automated match to d3g3ca_ |
PDB Entry: 5ewt (more details), 1.8 Å
SCOPe Domain Sequences for d5ewta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ewta_ d.151.1.0 (A:) automated matches {Sulfolobus islandicus [TaxId: 930945]} mkivswnvngiraalkknlidfiennmfevimfqetkgdivpldfimmgyevisfpakrk gysgvmtltkikpinvikglqikefddegrtvtlelkdfyvinaafpragdnlerldfkl kfnneienfvlklrrakpvilcgdfniahqnidgafsdptipgltpqerswfshflslgf idtfrylhpnvrkyswwsymgkareknlglrldycivseelkdrikmadilidiqgsdha piilelt
Timeline for d5ewta_: