Lineage for d5ewta_ (5ewt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988320Species Sulfolobus islandicus [TaxId:930945] [326429] (1 PDB entry)
  8. 2988321Domain d5ewta_: 5ewt A: [326430]
    automated match to d3g3ca_

Details for d5ewta_

PDB Entry: 5ewt (more details), 1.8 Å

PDB Description: crystal structure of exoiii endonuclease from sulfolobus islandicus
PDB Compounds: (A:) Exodeoxyribonuclease III Xth

SCOPe Domain Sequences for d5ewta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ewta_ d.151.1.0 (A:) automated matches {Sulfolobus islandicus [TaxId: 930945]}
mkivswnvngiraalkknlidfiennmfevimfqetkgdivpldfimmgyevisfpakrk
gysgvmtltkikpinvikglqikefddegrtvtlelkdfyvinaafpragdnlerldfkl
kfnneienfvlklrrakpvilcgdfniahqnidgafsdptipgltpqerswfshflslgf
idtfrylhpnvrkyswwsymgkareknlglrldycivseelkdrikmadilidiqgsdha
piilelt

SCOPe Domain Coordinates for d5ewta_:

Click to download the PDB-style file with coordinates for d5ewta_.
(The format of our PDB-style files is described here.)

Timeline for d5ewta_: