Lineage for d5ft8h1 (5ft8 H:6-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007689Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 3007697Protein automated matches [191012] (4 species)
    not a true protein
  7. 3007704Species Escherichia coli [TaxId:83333] [326403] (2 PDB entries)
  8. 3007709Domain d5ft8h1: 5ft8 H:6-147 [326427]
    Other proteins in same PDB: d5ft8a_, d5ft8b2, d5ft8c_, d5ft8d2, d5ft8e_, d5ft8g_, d5ft8h2, d5ft8i_, d5ft8k_, d5ft8m_, d5ft8o_
    automated match to d4lw4c_
    complexed with css, gol, peg, plp

Details for d5ft8h1

PDB Entry: 5ft8 (more details), 2.5 Å

PDB Description: crystal structure of the complex between the cysteine desulfurase csda and the sulfur-acceptor csde in the persulfurated state at 2.50 angstroem resolution
PDB Compounds: (H:) sulfur acceptor protein csde

SCOPe Domain Sequences for d5ft8h1:

Sequence, based on SEQRES records: (download)

>d5ft8h1 d.224.1.1 (H:6-147) automated matches {Escherichia coli [TaxId: 83333]}
faghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrv
wlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraql
sasrsqglnalseaiiaatkqv

Sequence, based on observed residues (ATOM records): (download)

>d5ft8h1 d.224.1.1 (H:6-147) automated matches {Escherichia coli [TaxId: 83333]}
faghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagenrvw
lgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqls
asrsqglnalseaiiaatkqv

SCOPe Domain Coordinates for d5ft8h1:

Click to download the PDB-style file with coordinates for d5ft8h1.
(The format of our PDB-style files is described here.)

Timeline for d5ft8h1: