Lineage for d5fjtb1 (5fjt B:1-125)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191576Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2191584Domain d5fjtb1: 5fjt B:1-125 [326425]
    Other proteins in same PDB: d5fjta2, d5fjtb2, d5fjtc2, d5fjtd2
    automated match to d1sjda2
    complexed with 5cr, mg; mutant

Details for d5fjtb1

PDB Entry: 5fjt (more details), 2.11 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d f323 mutant in complex with n-acetyl phenylalanine
PDB Compounds: (B:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjtb1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjtb1:

Click to download the PDB-style file with coordinates for d5fjtb1.
(The format of our PDB-style files is described here.)

Timeline for d5fjtb1: