Lineage for d5h4ga_ (5h4g A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529111Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2529112Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2529113Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2529151Protein Hypothetical protein PH0500 [142112] (2 species)
  7. 2529157Species Pyrococcus horikoshii [TaxId:70601] [326423] (2 PDB entries)
  8. 2529158Domain d5h4ga_: 5h4g A: [326424]
    automated match to d1v96a1
    complexed with zn

Details for d5h4ga_

PDB Entry: 5h4g (more details), 1.77 Å

PDB Description: structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 1.77 a resolution
PDB Compounds: (A:) Ribonuclease VapC4

SCOPe Domain Sequences for d5h4ga_:

Sequence, based on SEQRES records: (download)

>d5h4ga_ c.120.1.1 (A:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmvekel

Sequence, based on observed residues (ATOM records): (download)

>d5h4ga_ c.120.1.1 (A:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltarayknieaefeil
kdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkryepi
rrfgldtmpldkfikevelmvekel

SCOPe Domain Coordinates for d5h4ga_:

Click to download the PDB-style file with coordinates for d5h4ga_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ga_: