SCOPe 2.01: Domain d1d1qa_: 1d1q A:

Lineage for d1d1qa_ (1d1q A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)

8. Domain d1d1qa_: 1d1q A: [32642]
   complexed with 4np, gol, po4

Details for d1d1qa_

PDB Entry: 1d1q, 1.7 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp

PDB Compounds: (A:) tyrosine phosphatase (e.c.3.1.3.48)

SCOPe Domain Sequences for d1d1qa_:

Sequence; same for both SEQRES and ATOM records:

>d1d1qa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrt
vsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwnt
ndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel

Timeline for d1d1qa_:

• d1d1qa_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1qa_ appears in SCOP 1.75
  
• d1d1qa_ appears in SCOPe 2.02
  
• d1d1qa_ appears in the current release, SCOPe 2.08