Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1d1qa_ (1d1q A:)

  1. Root: SCOP 1.75
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 protein domains)
  6. Protein Tyrosine phosphatase [52790] (4 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)
  8. Domain d1d1qa_: 1d1q A: [32642]

Details for d1d1qa_

PDB Entry: 1d1q (more details)
PDB Description: crystal structure of a yeast low molecular weight protein ty phosphatase (ltp1) complexed with the substrate pnpp
PDB Compounds: (A:) tyrosine phosphatase (e.c.3.1.3.48)

SCOP Domain Sequences for d1d1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1qa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrt
vsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwnt
ndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel

SCOP Domain Coordinates for d1d1qa_:

Click to download the PDB-style file with coordinates for d1d1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1d1qa_:

d1d1qa_ appears in SCOP 1.73
d1d1qa_ appears in SCOP 1.75A


d1d1qa_
(click for larger image)


d1d1qa_ in context of chain



d1d1qa_ in context of PDB
Domains from other chains:
d1d1qb_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu