Lineage for d1d1qa_ (1d1q A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123014Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
  4. 123015Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
  5. 123016Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 123026Protein Tyrosine phosphatase [52790] (3 species)
  7. 123027Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52793] (3 PDB entries)
  8. 123028Domain d1d1qa_: 1d1q A: [32642]

Details for d1d1qa_

PDB Entry: 1d1q (more details), 1.7 Å

PDB Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp

SCOP Domain Sequences for d1d1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1qa_ c.44.1.1 (A:) Tyrosine phosphatase {Baker's yeast (Saccharomyces cerevisiae)}
iekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrt
vsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwnt
ndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel

SCOP Domain Coordinates for d1d1qa_:

Click to download the PDB-style file with coordinates for d1d1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1d1qa_: