Lineage for d5b1jc_ (5b1j C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772532Species Hyphomicrobium denitrificans [TaxId:53399] [188702] (2 PDB entries)
  8. 2772536Domain d5b1jc_: 5b1j C: [326413]
    Other proteins in same PDB: d5b1ja1, d5b1ja2, d5b1jb1, d5b1jb2
    automated match to d3ef4a_
    complexed with cu

Details for d5b1jc_

PDB Entry: 5b1j (more details), 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
PDB Compounds: (C:) Blue copper protein

SCOPe Domain Sequences for d5b1jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1jc_ b.6.1.0 (C:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aehivemrnkddagntmvfqpgfvkveagdtvkfvptdkshnaesvrevwpegvapvkgg
fskevvfnaekeglyvlkcaphygmgmvvlvqvgkpvnldqikeykatglakkrldgeia
kvvq

SCOPe Domain Coordinates for d5b1jc_:

Click to download the PDB-style file with coordinates for d5b1jc_.
(The format of our PDB-style files is described here.)

Timeline for d5b1jc_: