Lineage for d5pnt__ (5pnt -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70654Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
  4. 70655Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
  5. 70656Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein)
  6. 70657Protein Tyrosine phosphatase [52790] (3 species)
  7. 70672Species Human (Homo sapiens) [TaxId:9606] [52792] (1 PDB entry)
  8. 70673Domain d5pnt__: 5pnt - [32641]

Details for d5pnt__

PDB Entry: 5pnt (more details), 2.2 Å

PDB Description: crystal structure of a human low molecular weight phosphotyrosyl phosphatase. implications for substrate specificity

SCOP Domain Sequences for d5pnt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pnt__ c.44.1.1 (-) Tyrosine phosphatase {Human (Homo sapiens)}
aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgq
scmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
pqkqliiedpyygndsdfetvyqqcvrccraflekah

SCOP Domain Coordinates for d5pnt__:

Click to download the PDB-style file with coordinates for d5pnt__.
(The format of our PDB-style files is described here.)

Timeline for d5pnt__: