SCOPe 2.08: Domain d5pnta_: 5pnt A:

Lineage for d5pnta_ (5pnt A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
   automatically mapped to Pfam PF01451

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries)

8. Domain d5pnta_: 5pnt A: [32641]
   complexed with mes

Details for d5pnta_

PDB Entry: 5pnt, 2.2 Å

PDB Description: crystal structure of a human low molecular weight phosphotyrosyl phosphatase. implications for substrate specificity

PDB Compounds: (A:) low molecular weight phosphotyrosyl phosphatase

SCOPe Domain Sequences for d5pnta_:

Sequence; same for both SEQRES and ATOM records:

>d5pnta_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgq
scmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
pqkqliiedpyygndsdfetvyqqcvrccraflekah

Timeline for d5pnta_:

• d5pnta_ first appeared (with stable ids) in SCOP 1.55, called d5pnt__
  
• d5pnta_ appears in SCOPe 2.07