SCOPe 2.08: Domain d5eu9b1: 5eu9 B:2-140

Lineage for d5eu9b1 (5eu9 B:2-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
   Uniprot P09104

8. Domain d5eu9b1: 5eu9 B:2-140 [326400]
   Other proteins in same PDB: d5eu9a2, d5eu9b2, d5eu9c2, d5eu9c3, d5eu9d2, d5eu9e2, d5eu9f2, d5eu9f3, d5eu9g2, d5eu9h2
   automated match to d2akza2
   complexed with 5tx, mg, pge

Details for d5eu9b1

PDB Entry: 5eu9, 2.05 Å

PDB Description: structure of human enolase 2 in complex with ((3s,5s)-1,5-dihydroxy-3- methyl-2-oxopyrrolidin-3-yl)phosphonic acid

PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d5eu9b1:

Sequence; same for both SEQRES and ATOM records:

>d5eu9b1 d.54.1.1 (B:2-140) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d5eu9b1:

• d5eu9b1 first appeared in SCOPe 2.06
  
• d5eu9b1 appears in SCOPe 2.07