SCOP 1.75: Domain d1bvha_: 1bvh A:

Lineage for d1bvha_ (1bvh A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Tyrosine phosphatase [52790] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)

8. Domain d1bvha_: 1bvh A: [32640]

Details for d1bvha_

PDB Entry: 1bvh

PDB Description: solution structure of a low molecular weight protein tyrosine phosphatase

PDB Compounds: (A:) acid phosphatase

SCOP Domain Sequences for d1bvha_:

Sequence; same for both SEQRES and ATOM records:

>d1bvha_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

Timeline for d1bvha_:

• d1bvha_ first appeared (with stable ids) in SCOP 1.55, called d1bvh__
  
• d1bvha_ appears in SCOP 1.73
  
• d1bvha_ appears in SCOPe 2.01
  
• d1bvha_ appears in the current release, SCOPe 2.08