Lineage for d1bvha_ (1bvh A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698612Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 698613Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 698614Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 698638Protein Tyrosine phosphatase [52790] (4 species)
  7. 698646Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)
  8. 698654Domain d1bvha_: 1bvh A: [32640]

Details for d1bvha_

PDB Entry: 1bvh (more details)

PDB Description: solution structure of a low molecular weight protein tyrosine phosphatase
PDB Compounds: (A:) acid phosphatase

SCOP Domain Sequences for d1bvha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvha_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

SCOP Domain Coordinates for d1bvha_:

Click to download the PDB-style file with coordinates for d1bvha_.
(The format of our PDB-style files is described here.)

Timeline for d1bvha_: