Lineage for d5ep8a3 (5ep8 A:331-433)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552135Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2552153Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2552154Protein automated matches [254643] (5 species)
    not a true protein
  7. 2552155Species Bacillus subtilis [TaxId:224308] [326395] (2 PDB entries)
  8. 2552158Domain d5ep8a3: 5ep8 A:331-433 [326396]
    Other proteins in same PDB: d5ep8a1, d5ep8a2, d5ep8b1, d5ep8b2
    automated match to d3h5qa3
    complexed with na, so4

Details for d5ep8a3

PDB Entry: 5ep8 (more details), 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion
PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ep8a3 d.41.3.0 (A:331-433) automated matches {Bacillus subtilis [TaxId: 224308]}
qaayqidvpakeagvvseivadeigvaamllgagratkedeidlavgimlrkkvgdkvek
geplvtlyanrenvdeviakvydniriaaeakapklihtlite

SCOPe Domain Coordinates for d5ep8a3:

Click to download the PDB-style file with coordinates for d5ep8a3.
(The format of our PDB-style files is described here.)

Timeline for d5ep8a3: