Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) |
Family d.41.3.0: automated matches [254277] (1 protein) not a true family |
Protein automated matches [254643] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [326395] (2 PDB entries) |
Domain d5ep8a3: 5ep8 A:331-433 [326396] Other proteins in same PDB: d5ep8a1, d5ep8a2, d5ep8b1, d5ep8b2 automated match to d3h5qa3 complexed with na, so4 |
PDB Entry: 5ep8 (more details), 2.66 Å
SCOPe Domain Sequences for d5ep8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ep8a3 d.41.3.0 (A:331-433) automated matches {Bacillus subtilis [TaxId: 224308]} qaayqidvpakeagvvseivadeigvaamllgagratkedeidlavgimlrkkvgdkvek geplvtlyanrenvdeviakvydniriaaeakapklihtlite
Timeline for d5ep8a3: