Lineage for d1c0eb_ (1c0e B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) 
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein) Protein Tyrosine phosphatase [52790] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [52791] (5 PDB entries) 
Domain d1c0eb_: 1c0e B: [32639]
Details for d1c0eb_
PDB Entry: 1c0e (more details), 2.2 Å
PDB Description: active site s19a mutant of bovine heart phosphotyrosyl phosphatase
SCOP Domain Sequences for d1c0eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0eb_ c.44.1.1 (B:) Tyrosine phosphatase {Cow (Bos taurus)}
vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr
SCOP Domain Coordinates for d1c0eb_:
Click to download the PDB-style file with coordinates for d1c0eb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c0eb_:
- d1c0eb_ appears in SCOP 1.57
- d1c0eb_ appears in the current release, SCOPe 2.08
View in 3D
