Lineage for d1c0eb_ (1c0e B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23986Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
  4. 23987Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
  5. 23988Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein)
  6. 23989Protein Tyrosine phosphatase [52790] (3 species)
  7. 23997Species Cow (Bos taurus) [TaxId:9913] [52791] (5 PDB entries)
  8. 24002Domain d1c0eb_: 1c0e B: [32639]

Details for d1c0eb_

PDB Entry: 1c0e (more details), 2.2 Å

PDB Description: Active Site S19A Mutant of Bovine Heart Phosphotyrosyl Phosphatase

SCOP Domain Sequences for d1c0eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0eb_ c.44.1.1 (B:) Tyrosine phosphatase {Cow (Bos taurus)}
vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

SCOP Domain Coordinates for d1c0eb_:

Click to download the PDB-style file with coordinates for d1c0eb_.
(The format of our PDB-style files is described here.)

Timeline for d1c0eb_: