SCOPe 2.08: Domain d5b1jb2: 5b1j B:160-335

Lineage for d5b1jb2 (5b1j B:160-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries)

8. Domain d5b1jb2: 5b1j B:160-335 [326387]
   Other proteins in same PDB: d5b1jc_
   automated match to d1oe1a2
   complexed with cu

Details for d5b1jb2

PDB Entry: 5b1j, 3 Å

PDB Description: crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5b1jb2:

Sequence; same for both SEQRES and ATOM records:

>d5b1jb2 b.6.1.3 (B:160-335) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapip

Timeline for d5b1jb2:

• d5b1jb2 first appeared in SCOPe 2.06
  
• d5b1jb2 appears in SCOPe 2.07