| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein automated matches [226877] (4 species) not a true protein |
| Species Alcaligenes xylosoxydans [TaxId:85698] [225578] (6 PDB entries) |
| Domain d5b1jb1: 5b1j B:2-159 [326386] Other proteins in same PDB: d5b1jc_ automated match to d1gs7a1 complexed with cu |
PDB Entry: 5b1j (more details), 3 Å
SCOPe Domain Sequences for d5b1jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1jb1 b.6.1.3 (B:2-159) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
Timeline for d5b1jb1: