SCOPe 2.07: Domain d1c0ea_: 1c0e A:

Lineage for d1c0ea_ (1c0e A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
   automatically mapped to Pfam PF01451

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52791] (9 PDB entries)

8. Domain d1c0ea_: 1c0e A: [32638]
   complexed with po4; mutant

Details for d1c0ea_

PDB Entry: 1c0e, 2.2 Å

PDB Description: active site s19a mutant of bovine heart phosphotyrosyl phosphatase

PDB Compounds: (A:) protein (tyrosine phosphatase (orthophosphoric monoester phosphohydrolase))

SCOPe Domain Sequences for d1c0ea_:

Sequence; same for both SEQRES and ATOM records:

>d1c0ea_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

Timeline for d1c0ea_:

• d1c0ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1c0ea_ appears in SCOPe 2.06
  
• d1c0ea_ appears in the current release, SCOPe 2.08