Lineage for d1c0ea_ (1c0e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874853Protein Tyrosine phosphatase [52790] (5 species)
  7. 2874861Species Cow (Bos taurus) [TaxId:9913] [52791] (9 PDB entries)
  8. 2874866Domain d1c0ea_: 1c0e A: [32638]
    complexed with po4; mutant

Details for d1c0ea_

PDB Entry: 1c0e (more details), 2.2 Å

PDB Description: active site s19a mutant of bovine heart phosphotyrosyl phosphatase
PDB Compounds: (A:) protein (tyrosine phosphatase (orthophosphoric monoester phosphohydrolase))

SCOPe Domain Sequences for d1c0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0ea_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

SCOPe Domain Coordinates for d1c0ea_:

Click to download the PDB-style file with coordinates for d1c0ea_.
(The format of our PDB-style files is described here.)

Timeline for d1c0ea_: