Lineage for d1dg9a_ (1dg9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851593Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 1851594Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 1851618Protein Tyrosine phosphatase [52790] (5 species)
  7. 1851626Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)
  8. 1851627Domain d1dg9a_: 1dg9 A: [32637]
    complexed with epe

Details for d1dg9a_

PDB Entry: 1dg9 (more details), 1.9 Å

PDB Description: crystal structure of bovine low molecular weight ptpase complexed with hepes
PDB Compounds: (A:) tyrosine phosphatase

SCOPe Domain Sequences for d1dg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg9a_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

SCOPe Domain Coordinates for d1dg9a_:

Click to download the PDB-style file with coordinates for d1dg9a_.
(The format of our PDB-style files is described here.)

Timeline for d1dg9a_: