SCOPe 2.02: Domain d1dg9a_: 1dg9 A:

Lineage for d1dg9a_ (1dg9 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)

8. Domain d1dg9a_: 1dg9 A: [32637]
   complexed with epe

Details for d1dg9a_

PDB Entry: 1dg9, 1.9 Å

PDB Description: crystal structure of bovine low molecular weight ptpase complexed with hepes

PDB Compounds: (A:) tyrosine phosphatase

SCOPe Domain Sequences for d1dg9a_:

Sequence; same for both SEQRES and ATOM records:

>d1dg9a_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

Timeline for d1dg9a_:

• d1dg9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dg9a_ appears in SCOPe 2.01
  
• d1dg9a_ appears in SCOPe 2.03
  
• d1dg9a_ appears in the current release, SCOPe 2.08