Lineage for d1pnt__ (1pnt -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) 
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein) Protein Tyrosine phosphatase [52790] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [52791] (5 PDB entries) 
Domain d1pnt__: 1pnt - [32636]
Details for d1pnt__
PDB Entry: 1pnt (more details), 2.2 Å
PDB Description: crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution
SCOP Domain Sequences for d1pnt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnt__ c.44.1.1 (-) Tyrosine phosphatase {Cow (Bos taurus)}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr
SCOP Domain Coordinates for d1pnt__:
Click to download the PDB-style file with coordinates for d1pnt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pnt__:
- d1pnt__ first appeared (with stable ids) in SCOP 1.55
- d1pnt__ appears in SCOP 1.59
- d1pnt__ appears in the current release, SCOPe 2.08, called d1pnta_
View in 3D