Lineage for d1pnt__ (1pnt -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23986Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
  4. 23987Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
  5. 23988Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (1 protein)
  6. 23989Protein Tyrosine phosphatase [52790] (3 species)
  7. 23997Species Cow (Bos taurus) [TaxId:9913] [52791] (5 PDB entries)
  8. 23999Domain d1pnt__: 1pnt - [32636]

Details for d1pnt__

PDB Entry: 1pnt (more details), 2.2 Å

PDB Description: crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution

SCOP Domain Sequences for d1pnt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnt__ c.44.1.1 (-) Tyrosine phosphatase {Cow (Bos taurus)}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

SCOP Domain Coordinates for d1pnt__:

Click to download the PDB-style file with coordinates for d1pnt__.
(The format of our PDB-style files is described here.)

Timeline for d1pnt__: