Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries) |
Domain d5elnd1: 5eln D:46-189 [326357] Other proteins in same PDB: d5elna2, d5elna3, d5elnb2, d5elnb3, d5elnc2, d5elnc3, d5elnd2, d5elnd3 automated match to d3bjud1 protein/RNA complex; complexed with edo, gol, lys |
PDB Entry: 5eln (more details), 1.9 Å
SCOPe Domain Sequences for d5elnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elnd1 b.40.4.0 (D:46-189) automated matches {Cryptosporidium parvum [TaxId: 353152]} hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr gelslfsksvvllspcyhmlptai
Timeline for d5elnd1: