SCOPe 2.01: Domain d1phra_: 1phr A:

Lineage for d1phra_ (1phr A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)

8. Domain d1phra_: 1phr A: [32635]
   complexed with so4

Details for d1phra_

PDB Entry: 1phr, 2.1 Å

PDB Description: the crystal structure of a low molecular phosphotyrosine protein phosphatase

PDB Compounds: (A:) low molecular weight phosphotyrosine protein phosphotase

SCOPe Domain Sequences for d1phra_:

Sequence; same for both SEQRES and ATOM records:

>d1phra_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

Timeline for d1phra_:

• d1phra_ first appeared (with stable ids) in SCOP 1.55, called d1phr__
  
• d1phra_ appears in SCOP 1.75
  
• d1phra_ appears in SCOPe 2.02
  
• d1phra_ appears in the current release, SCOPe 2.08