Lineage for d1phra_ (1phr A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833067Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 833068Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 833069Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 833093Protein Tyrosine phosphatase [52790] (4 species)
  7. 833101Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)
  8. 833103Domain d1phra_: 1phr A: [32635]
    complexed with so4

Details for d1phra_

PDB Entry: 1phr (more details), 2.1 Å

PDB Description: the crystal structure of a low molecular phosphotyrosine protein phosphatase
PDB Compounds: (A:) low molecular weight phosphotyrosine protein phosphotase

SCOP Domain Sequences for d1phra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phra_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

SCOP Domain Coordinates for d1phra_:

Click to download the PDB-style file with coordinates for d1phra_.
(The format of our PDB-style files is described here.)

Timeline for d1phra_: