Lineage for d5elob2 (5elo B:194-545)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208934Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2208935Protein automated matches [226887] (13 species)
    not a true protein
  7. 2208952Species Cryptosporidium parvum [TaxId:353152] [326196] (2 PDB entries)
  8. 2208958Domain d5elob2: 5elo B:194-545 [326349]
    Other proteins in same PDB: d5eloa1, d5eloa3, d5elob1, d5elob3, d5eloc1, d5eloc3, d5elod1, d5elod3
    automated match to d3bjuc2
    protein/RNA complex; complexed with edo, krs, lys, so4

Details for d5elob2

PDB Entry: 5elo (more details), 1.9 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and cladosporin
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5elob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elob2 d.104.1.0 (B:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar
pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy
mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie
sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii
dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd
veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

SCOPe Domain Coordinates for d5elob2:

Click to download the PDB-style file with coordinates for d5elob2.
(The format of our PDB-style files is described here.)

Timeline for d5elob2: