![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Pyrobaculum sp. [TaxId:1104324] [228031] (9 PDB entries) |
![]() | Domain d5ekcb_: 5ekc B: [326345] automated match to d4nmkc_ complexed with nap |
PDB Entry: 5ekc (more details), 1.9 Å
SCOPe Domain Sequences for d5ekcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ekcb_ c.82.1.0 (B:) automated matches {Pyrobaculum sp. [TaxId: 1104324]} imkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawani pairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyq grvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpv tgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaag tlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfie ryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffe paifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafri aeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfp ipsal
Timeline for d5ekcb_: