Lineage for d5trta_ (5trt A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2104213Protein automated matches [190085] (51 species)
    not a true protein
  7. 2104324Species Burkholderia pseudomallei [TaxId:320372] [188614] (3 PDB entries)
  8. 2104329Domain d5trta_: 5trt A: [326342]
    automated match to d4rlhb_
    complexed with edo, nad

Details for d5trta_

PDB Entry: 5trt (more details), 1.85 Å

PDB Description: crystal structure of enoyl-(acyl carrier protein) reductase from burkholderia pseudomallei 1710b bound to nad
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5trta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trta_ c.2.1.2 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
taevmhvdsgfnavvggma

SCOPe Domain Coordinates for d5trta_:

Click to download the PDB-style file with coordinates for d5trta_.
(The format of our PDB-style files is described here.)

Timeline for d5trta_: