Lineage for d5ekda_ (5ekd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860964Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries)
  8. 2860969Domain d5ekda_: 5ekd A: [326333]
    automated match to d2el7b_
    protein/RNA complex; complexed with 5bx, atp, gol, mn

Details for d5ekda_

PDB Entry: 5ekd (more details), 1.82 Å

PDB Description: human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp.
PDB Compounds: (A:) Tryptophan--tRNA ligase, mitochondrial

SCOPe Domain Sequences for d5ekda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ekda_ c.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkrvfsgiqptgilhlgnylgaieswvrlqdeydsvlysivdlhsitvpqdpavlrqsil
dmtavllacginpeksilfqqsqvsehtqlswilscmvrlprlqhlhqwkakttkqkhdg
tvglltypvlqaadillyksthvpvgedqvqhmelvqdlaqgfnkkygeffpvpesilts
mkkvkslrdpsakmsksdpdklatvritdspeeivqkfrkavtdftsevtydpagragvs
nivavhaavtglsveevvrrsagmntaryklavadaviekfapikreieklkldkdhlek
vlqigsakakelaytvcqevkklvgfl

SCOPe Domain Coordinates for d5ekda_:

Click to download the PDB-style file with coordinates for d5ekda_.
(The format of our PDB-style files is described here.)

Timeline for d5ekda_: