Lineage for d5t9pa_ (5t9p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952490Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)
  8. 2952494Domain d5t9pa_: 5t9p A: [326329]
    automated match to d1d8za_
    complexed with cl, so4

Details for d5t9pa_

PDB Entry: 5t9p (more details), 2 Å

PDB Description: structural analysis reveals the flexible c-terminus of nop15 undergoes rearrangement to recognize a pre-ribosomal rna folding intermediate
PDB Compounds: (A:) Ribosome biogenesis protein 15

SCOPe Domain Sequences for d5t9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9pa_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkedami
aqesmnnyllmghllqvrvlpkgakieklykykkrvl

SCOPe Domain Coordinates for d5t9pa_:

Click to download the PDB-style file with coordinates for d5t9pa_.
(The format of our PDB-style files is described here.)

Timeline for d5t9pa_: