SCOPe 2.08: Domain d5tkaa_: 5tka A:

Lineage for d5tkaa_ (5tka A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [326307] (5 PDB entries)

8. Domain d5tkaa_: 5tka A: [326323]
   automated match to d2paua_
   complexed with edo, mg

Details for d5tkaa_

PDB Entry: 5tka, 2.05 Å

PDB Description: structure of the hd-domain phosphohydrolase oxsa

PDB Compounds: (A:) OxsA protein

SCOPe Domain Sequences for d5tkaa_:

Sequence, based on SEQRES records:

>d5tkaa_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
dfplenkny

Sequence, based on observed residues (ATOM records):

>d5tkaa_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthknslfdnlpitlsdtlstilnnndleiqeivehadhvdayckscie
vhrgnkdfisiqrslgdkldnltkeypylkefqnlflkdfplenkny

Timeline for d5tkaa_:

• d5tkaa_ first appeared in SCOPe 2.06
  
• d5tkaa_ appears in SCOPe 2.07