SCOPe 2.06: Domain d5tk7a_: 5tk7 A:

Lineage for d5tk7a_ (5tk7 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [326307] (5 PDB entries)

8. Domain d5tk7a_: 5tk7 A: [326318]
   automated match to d2paua_
   complexed with 7d4, mg

Details for d5tk7a_

PDB Entry: 5tk7, 1.9 Å

PDB Description: structure of the hd-domain phosphohydrolase oxsa with oxetanocin-a triphosphate bound

PDB Compounds: (A:) OxsA protein

SCOPe Domain Sequences for d5tk7a_:

Sequence; same for both SEQRES and ATOM records:

>d5tk7a_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
dfplenknyry

Timeline for d5tk7a_:

• d5tk7a_ is new in SCOPe 2.06-stable
  
• d5tk7a_ appears in SCOPe 2.07
  
• d5tk7a_ appears in the current release, SCOPe 2.08