SCOPe 2.08: Domain d5tqlb_: 5tql B:

Lineage for d5tqlb_ (5tql B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [51371] (12 PDB entries)

8. Domain d5tqlb_: 5tql B: [326315]
   automated match to d1thfd_
   complexed with po4

Details for d5tqlb_

PDB Entry: 5tql, 1.9 Å

PDB Description: crystal structure of tim-barrel protein hisf-c9s

PDB Compounds: (B:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d5tqlb_:

Sequence; same for both SEQRES and ATOM records:

>d5tqlb_ c.1.2.1 (B:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
lakriiasldvkdgrvvkgsnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrl

Timeline for d5tqlb_:

• d5tqlb_ first appeared in SCOPe 2.06
  
• d5tqlb_ appears in SCOPe 2.07