![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [225261] (5 PDB entries) |
![]() | Domain d5hfjd_: 5hfj D: [326313] automated match to d1g60a_ protein/DNA complex; complexed with sam |
PDB Entry: 5hfj (more details), 3.1 Å
SCOPe Domain Sequences for d5hfjd_:
Sequence, based on SEQRES records: (download)
>d5hfjd_ c.66.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]} miqiyhadafeiikdfyqqnlkvdaiitdppynisvknnfptlksakrqgidfgewdknf kllewiaryaplvnpngcmvifcsyrfisyiadfleengfvvkdfiqwvknnpmprnihr ryvqdtefalwavkkkakwvfnkpknekylrplilkspvvsglektkhptqkslalmeki isihtnpndivldpfmgsgttglacknlernfigiesekeyfqtakkrlnl
>d5hfjd_ c.66.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]} miqiyhadafeiikdfyqqnlkvdaiitdppfkllewiaryaplvnpngcmvifcsyrfi syiadfleengfvvkdfiqwvknnpmprnihrryvqdtefalwavkkkakwvfnkpknek ylrplilksslalmekiisihtnpndivldpfmgsgttglacknlernfigiesekeyfq takkrlnl
Timeline for d5hfjd_: