Lineage for d5hfjd_ (5hfj D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894658Species Helicobacter pylori [TaxId:85962] [225261] (5 PDB entries)
  8. 2894674Domain d5hfjd_: 5hfj D: [326313]
    automated match to d1g60a_
    protein/DNA complex; complexed with sam

Details for d5hfjd_

PDB Entry: 5hfj (more details), 3.1 Å

PDB Description: crystal structure of m1.hpyavi-sam complex
PDB Compounds: (D:) Adenine specific DNA methyltransferase (DpnA)

SCOPe Domain Sequences for d5hfjd_:

Sequence, based on SEQRES records: (download)

>d5hfjd_ c.66.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppynisvknnfptlksakrqgidfgewdknf
kllewiaryaplvnpngcmvifcsyrfisyiadfleengfvvkdfiqwvknnpmprnihr
ryvqdtefalwavkkkakwvfnkpknekylrplilkspvvsglektkhptqkslalmeki
isihtnpndivldpfmgsgttglacknlernfigiesekeyfqtakkrlnl

Sequence, based on observed residues (ATOM records): (download)

>d5hfjd_ c.66.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppfkllewiaryaplvnpngcmvifcsyrfi
syiadfleengfvvkdfiqwvknnpmprnihrryvqdtefalwavkkkakwvfnkpknek
ylrplilksslalmekiisihtnpndivldpfmgsgttglacknlernfigiesekeyfq
takkrlnl

SCOPe Domain Coordinates for d5hfjd_:

Click to download the PDB-style file with coordinates for d5hfjd_.
(The format of our PDB-style files is described here.)

Timeline for d5hfjd_: