Lineage for d1e2oa_ (1e2o A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115786Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2115787Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2115788Family c.43.1.1: CAT-like [52778] (3 protein domains)
    trimeric enzymes with the active sites being located in between subunits
  6. 2115858Protein Dihydrolipoamide succinyltransferase [52785] (1 species)
  7. 2115859Species Escherichia coli [TaxId:562] [52786] (3 PDB entries)
  8. 2115861Domain d1e2oa_: 1e2o A: [32631]
    complexed with so4

Details for d1e2oa_

PDB Entry: 1e2o (more details), 3 Å

PDB Description: catalytic domain from dihydrolipoamide succinyltransferase
PDB Compounds: (A:) dihydrolipoamide succinyltransferase

SCOPe Domain Sequences for d1e2oa_:

Sequence, based on SEQRES records: (download)

>d1e2oa_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]}
arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgm
adiekkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaik
drpmavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv

Sequence, based on observed residues (ATOM records): (download)

>d1e2oa_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]}
arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstglvtpvlrdvdtlgmad
iekkikelavkgdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaikdrp
mavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv

SCOPe Domain Coordinates for d1e2oa_:

Click to download the PDB-style file with coordinates for d1e2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1e2oa_: