| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
| Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
| Protein automated matches [190983] (12 species) not a true protein |
| Species Bacillus megaterium [TaxId:1404] [326307] (5 PDB entries) |
| Domain d5tk9a_: 5tk9 A: [326308] automated match to d2paua_ complexed with 7d7, mg |
PDB Entry: 5tk9 (more details), 1.84 Å
SCOPe Domain Sequences for d5tk9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tk9a_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
dfplenknyry
Timeline for d5tk9a_: