Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Peptoclostridium difficile [TaxId:1496] [326301] (1 PDB entry) |
Domain d5eria1: 5eri A:22-168 [326302] Other proteins in same PDB: d5eria2 automated match to d1lj9a_ |
PDB Entry: 5eri (more details), 2.3 Å
SCOPe Domain Sequences for d5eria1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eria1 a.4.5.0 (A:22-168) automated matches {Peptoclostridium difficile [TaxId: 1496]} iktldsnilrevgtlsravnsindikykelklqkgqftfltricenpginlvelsnmlkv dkatttkaiqklikagyvdkkqdkfdkrgynltptdkslevyeliieeenrsieicfdnf tdeekqvvtkllekmsknvenewfkvk
Timeline for d5eria1: