Lineage for d5eria1 (5eri A:22-168)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308369Species Peptoclostridium difficile [TaxId:1496] [326301] (1 PDB entry)
  8. 2308370Domain d5eria1: 5eri A:22-168 [326302]
    Other proteins in same PDB: d5eria2
    automated match to d1lj9a_

Details for d5eria1

PDB Entry: 5eri (more details), 2.3 Å

PDB Description: marr protein from peptoclostridium difficile da00132
PDB Compounds: (A:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d5eria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eria1 a.4.5.0 (A:22-168) automated matches {Peptoclostridium difficile [TaxId: 1496]}
iktldsnilrevgtlsravnsindikykelklqkgqftfltricenpginlvelsnmlkv
dkatttkaiqklikagyvdkkqdkfdkrgynltptdkslevyeliieeenrsieicfdnf
tdeekqvvtkllekmsknvenewfkvk

SCOPe Domain Coordinates for d5eria1:

Click to download the PDB-style file with coordinates for d5eria1.
(The format of our PDB-style files is described here.)

Timeline for d5eria1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5eria2