Lineage for d1b5se_ (1b5s E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874560Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 2874616Protein Dihydrolipoamide acetyltransferase [52782] (2 species)
  7. 2874627Species Bacillus stearothermophilus [TaxId:1422] [52784] (1 PDB entry)
  8. 2874632Domain d1b5se_: 1b5s E: [32630]

Details for d1b5se_

PDB Entry: 1b5s (more details), 4.4 Å

PDB Description: dihydrolipoyl transacetylase (e.c.2.3.1.12) catalytic domain (residues 184-425) from bacillus stearothermophilus
PDB Compounds: (E:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d1b5se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5se_ c.43.1.1 (E:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
aaakpattegefpetrekmsgirraiakamvhskhtaphvtlmdeadvtklvahrkkfka
iaaekgikltflpyvvkalvsalreypvlntsiddeteeiiqkhyynigiaadtdrgllv
pvikhadrkpifalaqeinelaekardgkltpgemkgasctitnigsaggqwftpvinhp
evailgigriaekpivrdgeivaapmlalslsfdhrmidgataqkalnhikrllsdpell
lm

SCOPe Domain Coordinates for d1b5se_:

Click to download the PDB-style file with coordinates for d1b5se_.
(The format of our PDB-style files is described here.)

Timeline for d1b5se_: