| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
| Family c.43.1.1: CAT-like [52778] (3 proteins) trimeric enzymes with the active sites being located in between subunits |
| Protein Dihydrolipoamide acetyltransferase [52782] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [52784] (1 PDB entry) |
| Domain d1b5se_: 1b5s E: [32630] |
PDB Entry: 1b5s (more details), 4.4 Å
SCOPe Domain Sequences for d1b5se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b5se_ c.43.1.1 (E:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
aaakpattegefpetrekmsgirraiakamvhskhtaphvtlmdeadvtklvahrkkfka
iaaekgikltflpyvvkalvsalreypvlntsiddeteeiiqkhyynigiaadtdrgllv
pvikhadrkpifalaqeinelaekardgkltpgemkgasctitnigsaggqwftpvinhp
evailgigriaekpivrdgeivaapmlalslsfdhrmidgataqkalnhikrllsdpell
lm
Timeline for d1b5se_:
View in 3DDomains from other chains: (mouse over for more information) d1b5sa_, d1b5sb_, d1b5sc_, d1b5sd_ |