SCOPe 2.08: Domain d5fjob1: 5fjo B:1-125

Lineage for d5fjob1 (5fjo B:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)

8. Domain d5fjob1: 5fjo B:1-125 [326297]
   Other proteins in same PDB: d5fjoa2, d5fjob2
   automated match to d1sjda2
   complexed with mg, npq; mutant

Details for d5fjob1

PDB Entry: 5fjo, 2.08 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d-f323y mutant in complex with n-acetyl naphthylalanine

SCOPe Domain Sequences for d5fjob1:

Sequence; same for both SEQRES and ATOM records:

>d5fjob1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d5fjob1:

• d5fjob1 first appeared in SCOPe 2.06
  
• d5fjob1 appears in SCOPe 2.07