SCOPe 2.08: Domain d5l2ja1: 5l2j A:4-183

Lineage for d5l2ja1 (5l2j A:4-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)

8. Domain d5l2ja1: 5l2j A:4-183 [326293]
   Other proteins in same PDB: d5l2ja2, d5l2ja3, d5l2jb_
   automated match to d3l9ra1
   complexed with 6ul, 70e, act, cl, na, nag

Details for d5l2ja1

PDB Entry: 5l2j, 1.65 Å

PDB Description: crystal structure of human cd1b in complex with c36-gmm

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5l2ja1:

Sequence; same for both SEQRES and ATOM records:

>d5l2ja1 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

Timeline for d5l2ja1:

• d5l2ja1 first appeared in SCOPe 2.06
  
• d5l2ja1 appears in SCOPe 2.07