SCOPe 2.07: Domain d5esab1: 5esa B:1-106

Lineage for d5esab1 (5esa B:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d5esab1: 5esa B:1-106 [326283]
   Other proteins in same PDB: d5esab2
   automated match to d1adql1

Details for d5esab1

PDB Entry: 5esa, 2.6 Å

PDB Description: crystal structure of anti-hcv e2 antibody hc84-26

PDB Compounds: (B:) Anti-HCV E2 glycoprotein Fab light chain

SCOPe Domain Sequences for d5esab1:

Sequence; same for both SEQRES and ATOM records:

>d5esab1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdsssvvfggwtkltvl

Timeline for d5esab1:

• d5esab1 first appeared in SCOPe 2.06
  
• d5esab1 appears in the current release, SCOPe 2.08