Lineage for d5esab1 (5esa B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743348Domain d5esab1: 5esa B:1-106 [326283]
    Other proteins in same PDB: d5esab2
    automated match to d1adql1

Details for d5esab1

PDB Entry: 5esa (more details), 2.6 Å

PDB Description: crystal structure of anti-hcv e2 antibody hc84-26
PDB Compounds: (B:) Anti-HCV E2 glycoprotein Fab light chain

SCOPe Domain Sequences for d5esab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5esab1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdsssvvfggwtkltvl

SCOPe Domain Coordinates for d5esab1:

Click to download the PDB-style file with coordinates for d5esab1.
(The format of our PDB-style files is described here.)

Timeline for d5esab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5esab2
View in 3D
Domains from other chains:
(mouse over for more information)
d5esaa_