Lineage for d1b5sb_ (1b5s B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851362Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1851363Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1851364Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 1851417Protein Dihydrolipoamide acetyltransferase [52782] (2 species)
  7. 1851428Species Bacillus stearothermophilus [TaxId:1422] [52784] (1 PDB entry)
  8. 1851430Domain d1b5sb_: 1b5s B: [32627]

Details for d1b5sb_

PDB Entry: 1b5s (more details), 4.4 Å

PDB Description: dihydrolipoyl transacetylase (e.c.2.3.1.12) catalytic domain (residues 184-425) from bacillus stearothermophilus
PDB Compounds: (B:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d1b5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5sb_ c.43.1.1 (B:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
aaakpattegefpetrekmsgirraiakamvhskhtaphvtlmdeadvtklvahrkkfka
iaaekgikltflpyvvkalvsalreypvlntsiddeteeiiqkhyynigiaadtdrgllv
pvikhadrkpifalaqeinelaekardgkltpgemkgasctitnigsaggqwftpvinhp
evailgigriaekpivrdgeivaapmlalslsfdhrmidgataqkalnhikrllsdpell
lm

SCOPe Domain Coordinates for d1b5sb_:

Click to download the PDB-style file with coordinates for d1b5sb_.
(The format of our PDB-style files is described here.)

Timeline for d1b5sb_: