SCOPe 2.08: Domain d5kb3a1: 5kb3 A:2-230

Lineage for d5kb3a1 (5kb3 A:2-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)

8. Domain d5kb3a1: 5kb3 A:2-230 [326269]
   Other proteins in same PDB: d5kb3a2
   automated match to d4p54a_
   complexed with 4ct, mg

Details for d5kb3a1

PDB Entry: 5kb3, 1.4 Å

PDB Description: 1.4 a resolution structure of helicobacter pylori mtan in complexed with p-clph-dadme-imma

PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d5kb3a1:

Sequence; same for both SEQRES and ATOM records:

>d5kb3a1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

Timeline for d5kb3a1:

• d5kb3a1 first appeared in SCOPe 2.06
  
• d5kb3a1 appears in SCOPe 2.07